Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.1627s0001.1.p
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family EIL
Protein Properties Length: 134aa    MW: 14793.7 Da    PI: 7.0425
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.1627s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                 EIN3 238 msakesfallsvlnqeekecatvsah.ssslrkqspkvtlsceqkedvegkk 288
                          m+ kes+++l+++nqee++ ++++++  + ++ +s ++++ +++++dv+g+k
                          899***********************5447788***************9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.3180.106.1E-4127IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 134 aa     Download sequence    Send to blast
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006432536.18e-40hypothetical protein CICLE_v10000608mg
RefseqXP_006432537.18e-40hypothetical protein CICLE_v10000608mg
RefseqXP_006432538.18e-40hypothetical protein CICLE_v10000608mg
RefseqXP_006432539.18e-40hypothetical protein CICLE_v10000608mg
TrEMBLA0A067EFG67e-41A0A067EFG6_CITSI; Uncharacterized protein
TrEMBLA0A067ESD35e-40A0A067ESD3_CITSI; Uncharacterized protein
STRINGVIT_13s0047g00250.t011e-37(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G20770.12e-23EIL family protein